Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0620400_circ_g.5 |
ID in PlantcircBase | osa_circ_034809 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 25647327-25648439 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0620400 |
Parent gene annotation |
Similar to GTP-binding protein-like. (Os07t0620400-01) |
Parent gene strand | - |
Alternative splicing | Os07g0620400_circ_g.1 Os07g0620400_circ_g.2 Os07g0620400_circ_g.3 Os07g0620400_circ_g.4 Os07g0620400_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0620400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017360 |
PMCS | 0.135687466 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25648381-25648427(-) 25647604-25648321(-) |
Potential amino acid sequence |
MFSLFYGLWQHVFSKAEFHVVILGVHKAGKTTLLEKVKSIYLKEEGLPHDRIVPTVGLNIGRIE DANVKLVFWDLGGQPGLRTIWEKYYEEAHAVIYVIDSAAASSFEDAKSALEKVLHHEDLQGVPL LIFANKQDVLC*(-) MLSYMLLTLLLHHHLKMPNLLWRKFFITRICKECLYSYLQTSRTYCVSGPLVELIVERKVLQQC SPCSMVYGSMSSARQSSM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |