Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0620400_circ_g.5 |
| ID in PlantcircBase | osa_circ_034809 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 25647327-25648439 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0620400 |
| Parent gene annotation |
Similar to GTP-binding protein-like. (Os07t0620400-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0620400_circ_g.1 Os07g0620400_circ_g.2 Os07g0620400_circ_g.3 Os07g0620400_circ_g.4 Os07g0620400_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0620400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017360 |
| PMCS | 0.135687466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25648381-25648427(-) 25647604-25648321(-) |
| Potential amino acid sequence |
MFSLFYGLWQHVFSKAEFHVVILGVHKAGKTTLLEKVKSIYLKEEGLPHDRIVPTVGLNIGRIE DANVKLVFWDLGGQPGLRTIWEKYYEEAHAVIYVIDSAAASSFEDAKSALEKVLHHEDLQGVPL LIFANKQDVLC*(-) MLSYMLLTLLLHHHLKMPNLLWRKFFITRICKECLYSYLQTSRTYCVSGPLVELIVERKVLQQC SPCSMVYGSMSSARQSSM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |