Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G29160_circ_g.2 |
| ID in PlantcircBase | ath_circ_024292 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 11129659-11129799 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G29160 |
| Parent gene annotation |
Non-specific serine/threonine protein kinase |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G29160.1:1 AT3G29160.3:1 AT3G29160.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.213944801 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11129782-11129661(-) |
| Potential amino acid sequence |
MRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDRKWALGLQDSGSNPMRTPEAGASPVGHWIPA HVDHYGLGARSQVPVDRKWALGLQDSGSNPMRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDR KWALGLQDSGSNPMRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDRKWALGLQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |