Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G23280_circ_g.1 |
| ID in PlantcircBase | ath_circ_004021 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 8261445-8261585 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G23280 |
| Parent gene annotation |
Protein MAK16 homolog |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G23280.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168439721 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8261568-8261447(-) |
| Potential amino acid sequence |
MERLKKGIYPTEIYNLSDSVFNKLLDREIETNDEVEKEEEEAIETELMERLKKGIYPTEIYNLS DSVFNKLLDREIETNDEVEKEEEEAIETELMERLKKGIYPTEIYNLSDSVFNKLLDREIETNDE VEKEEEEAIETELMERLKKGIYPTEIYNLSDSVFNKLLDREIETNDEVEKEEEE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |