Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d004977_circ_g.2 |
ID in PlantcircBase | zma_circ_007283 |
Alias | zma_circ_0000811 |
Organism | Zea mays |
Position | chr2: 151851056-151851316 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d004977 |
Parent gene annotation |
Cytochrome c-type biogenesis ccda-like chloroplastic protein |
Parent gene strand | + |
Alternative splicing | Zm00001d004977_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d004977_T001:2 Zm00001d004977_T002:2 Zm00001d004977_T003:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.027458174 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
151851286-151851058(+) 151851299-151851058(+) 151851124-151851298(-) |
Potential amino acid sequence |
MLPSYGTPWPCGSCSRSCQTGGSCDAGEALAPHPSGFRGRVESGCHWRRKCCRAMGPLGPVVAV RGVAKPEAAATPARRSRPIPLASVAVWSLVATGAANAAELWDPLALW*(+) MGPLGPVVAVRGVAKPEAAATPARRSRPIPLASVAVWSLVATGAANAAELWDPLALW*(+) MGRERLAGVAAASGLATPRTATTGPRGPIARQHLRRQWQPDSTRPRKPEGWGASASPASQLPPV WQLREQLPQGQGVP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |