Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0017s02970_circ_g.1 |
| ID in PlantcircBase | pop_circ_003956 |
| Alias | Chr17:14028837-14030227 |
| Organism | Populus trichocarpa |
| Position | chr17: 2136201-2137591 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0017s02970 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0017s02970.2:5 POPTR_0017s02970.3:5 POPTR_0017s02970.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112095321 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2137562-2136477(+) 2137556-2137567(-) |
| Potential amino acid sequence |
MLIFLFSNLCPPTPLEHLPLHVAWRGSQQGANQPPRLHHSNACQQQFSIWFELCPL*(+) MSGRTIHSCHALAEACRFVYNDAKFVNERARNDIILLSRGISRLDARARKGVAILGSGFLKLDA RAREDTEKIDRDVKEKAERLHHIATIIKDRAQTKLKTAADKHWSDGALEADLRLADFRAKQRAM EDALMALEGTSWRKGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |