Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0472000_circ_g.1 |
| ID in PlantcircBase | osa_circ_039533 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 18016281-18017419 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0472000 |
| Parent gene annotation |
Hypothetical protein. (Os09t0472000-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0471900-01:4 Os09t0472000-00:2 Os09t0471900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185061794 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18016323-18016322(+) |
| Potential amino acid sequence |
MIHQSTKPGMLPNALVVANDVDVQRCNLLIHQTKRMCTANLIVTNHEAQNFPGCNLAKFSSETC TDESKLQRLEFDRVLCDVPCSGDGTVRKAPDMWRKWNAGMGNGLHRLQVEIAMRGIGLLKVGGR IVYSTCSMNPVENEAVVAECALLQDQRPSSYLR*(+) |
| Sponge-miRNAs | osa-miR2105 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |