Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G35630_circ_g.54 |
| ID in PlantcircBase | ath_circ_016664 |
| Alias | At_ciR475 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14978836-14979210 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, circseq_cup, CIRI-full |
| Parent gene | AT2G35630 |
| Parent gene annotation |
Protein MOR1 |
| Parent gene strand | + |
| Alternative splicing | AT2G35630_circ_g.53 |
| Support reads | 11 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G35630.2:2 AT2G35630.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.319691391 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14978914-14979207(+) |
| Potential amino acid sequence |
MEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLELLQST IYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPID MRPQPIILAYIDLNLELLQSTIYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVL HELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLELLQSTIYEVDLDRLLQSIHVYLQDLGM EEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |