Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G35630_circ_g.54 |
ID in PlantcircBase | ath_circ_016664 |
Alias | At_ciR475 |
Organism | Arabidpsis thaliana |
Position | chr2: 14978836-14979210 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, circseq_cup, CIRI-full |
Parent gene | AT2G35630 |
Parent gene annotation |
Protein MOR1 |
Parent gene strand | + |
Alternative splicing | AT2G35630_circ_g.53 |
Support reads | 11 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G35630.2:2 AT2G35630.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.319691391 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14978914-14979207(+) |
Potential amino acid sequence |
MEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLELLQST IYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPID MRPQPIILAYIDLNLELLQSTIYEVDLDRLLQSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVL HELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLELLQSTIYEVDLDRLLQSIHVYLQDLGM EEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPIILAYIDLNLE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |