Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0470800_circ_g.2 |
ID in PlantcircBase | osa_circ_033729 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 16863841-16864658 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os07g0470800 |
Parent gene annotation |
Hypothetical conserved gene. (Os07t0470800-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0470800-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017041 |
PMCS | 0.184668735 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16864060-16864088(-) |
Potential amino acid sequence |
MLKAHTGHVHLDGTQIVTMAQRRVGGMKMTKMMNQVDLLGSGDTVGSGIQRIMVSAHMIFILET SEAGVDLSFAQVMKMNRKRCFAMLSVGNRHFIGLLILMIFVREITDVLIQKVPDVGVMRQMMRM KHPHRRRYLWHGRHLD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |