Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0470800_circ_g.2 |
| ID in PlantcircBase | osa_circ_033729 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 16863841-16864658 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os07g0470800 |
| Parent gene annotation |
Hypothetical conserved gene. (Os07t0470800-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0470800-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017041 |
| PMCS | 0.184668735 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16864060-16864088(-) |
| Potential amino acid sequence |
MLKAHTGHVHLDGTQIVTMAQRRVGGMKMTKMMNQVDLLGSGDTVGSGIQRIMVSAHMIFILET SEAGVDLSFAQVMKMNRKRCFAMLSVGNRHFIGLLILMIFVREITDVLIQKVPDVGVMRQMMRM KHPHRRRYLWHGRHLD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |