Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0159800_circ_g.3 |
| ID in PlantcircBase | osa_circ_006249 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 3801448-3801791 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0159800 |
| Parent gene annotation |
Alcohol dehydrogenase superfamily, zinc-containing protein. (Os1 0t0159800-01);Similar to Alcohol dehydrogenase 2. (Os10t0159800- 03);Similar to Alcohol dehydrogenase 2. (Os10t0159800-04) |
| Parent gene strand | - |
| Alternative splicing | Os10g0159800_circ_g.1 Os10g0159800_circ_g.2 Os10g0159800_circ_g.4 Os10g0159800_circ_g.5 Os10g0159800_circ_g.6 Os10g0159800_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0159800-03:1 Os10t0159800-01:1 Os10t0159800-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.110707364 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3801741-3801569(+) 3801639-3801606(-) |
| Potential amino acid sequence |
MISRGKILHTLSHALHHPVETPQLRRLIFSKGALGLILTAQAESITVYSAKVEVLRKW*(+) MVTDGGTRFTMIDRSSGARNPVYHFLNTSTFAEYTVIDSACAVKINPKAPLEKMSLLSCGVSTG WWRAWERVWRILPLEIMLSPSSPASVVRAPTASPARATYAKPTVSTHSRAPWSPMVARGSP*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |