Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G48090_circ_g.18 |
ID in PlantcircBase | ath_circ_006243 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 17740359-17740628 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G48090 |
Parent gene annotation |
calcium-dependent lipid-binding family protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 16 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G48090.1:1 AT1G48090.4:1 AT1G48090.2:1 AT1G48090.6:1 AT1G48090.3:1 AT1G48090.5:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.422753322 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17740386-17740361(-) |
Potential amino acid sequence |
MTVQILEAKESAASRESGDLSAFSALDEDDFQTIVVENKLGRDIYLKKLEENSDVVVKLCHDEN TSVWVPPPRFSNRLNVADSSREARNYMTVQILEAKESAASRESGDLSAFSALDEDDFQTIVVEN KLGRDIYLKKLEENSDVVVKLCHDENTSVWVPPPRFSNRLNVADSSREARNYMTVQILEAKESA ASRESGDLSAFSALDEDDFQTIVVENKLGRDIYLKKLEENSDVVVKLCHDENTSVWVPPPRFSN RLNVADSSREARNYMTVQILEAK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |