Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0189600_circ_g.10 |
| ID in PlantcircBase | osa_circ_008752 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 4554020-4554256 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os11g0189600 |
| Parent gene annotation |
Similar to Cycloartenol synthase. (Os11t0189600-01);Similar to c DNA clone:J013062J12, full insert sequence. (Os11t0189600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0189600-01:2 Os11t0189600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.409241878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4554075-4554253(+) 4554238-4554074(+) |
| Potential amino acid sequence |
MIALIDAGQAERDPVPLHRAAKALLNLQLEDGEFPQQVYTNLKGNRPHGTHTAWAMIALIDAGQ AERDPVPLHRAAKALLNLQLEDGEFPQQVYTNLKGNRPHGTHTAWAMIALIDAGQAERDPVPLH RAAKALLNLQLEDGEFPQQVYTNLKGNRPHGTHTAWAMIALIDAGQAERDPVPLHRAAKALLNL QLEDGEFPQQ(+) MENFHSKFTQILKATDLTVRTLRGP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |