Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014719_circ_g.1 | 
| ID in PlantcircBase | zma_circ_008500 | 
| Alias | Zm05circ00049, zma_circ_0001865, GRMZM2G347721_C1 | 
| Organism | Zea mays | 
| Position | chr5: 60365747-60367904 JBrowse» | 
| Reference genome | AGPv4.38 | 
| Type | u-circRNA | 
| Identification method | CIRI2, find_circ | 
| Parent gene | Zm00001d014719 | 
| Parent gene annotation | 
							Putative pentatricopeptide repeat-containing protein  | 
					
| Parent gene strand | - | 
| Alternative splicing | Zm00001d014717_circ_ag.1 Zm00001d014717_circ_ag.2 | 
| Support reads | NA | 
| Tissues | leaf, endosperm, root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | CT-AC | 
| Number of exons covered | Zm00001d014719_T010:4 Zm00001d014719_T017:4 Zm00001d014719_T001:4 Zm00001d014719_T002:4 Zm00001d014719_T011:4 Zm00001d014719_T012:4 Zm00001d014719_T023:4 Zm00001d014719_T009:4 Zm00001d014719_T006:4 Zm00001d014719_T021:4 Zm00001d014719_T019:4 Zm00001d014719_T003:4 Zm00001d014719_T013:4 Zm00001d014719_T004:4 Zm00001d014719_T020:4 Zm00001d014719_T015:4 Zm00001d014719_T018:4 Zm00001d014719_T005:4 Zm00001d014719_T022:4 Zm00001d014719_T014:4 Zm00001d014719_T008:4 Zm00001d014719_T007:4 Zm00001d014719_T016:4  | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA | 
| PMCS | 0.083236921 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							60366829-60365791(+) 60367876-60367806(-)  | 
					
| Potential amino acid sequence | 
							MLKLSPNKFSNAGLYLRVVGEGIDHFFLVHVHLKAAQYKTLDLYGLPLSNRRNLFPG*(+) MYMDQKEVVDALSHHSKIEPCITELVWRQLEHQNPLFFKAYYMRLMLKNQIMVFNKLLQDQFEV INKEFSSGIPSMSLPNGSNSNLLKQNPCFLPETAPGSAMPDGIMHNGSSRGIINGTPSGDQLLN ASKDLHGLHNGIDASTSLQSDQNAAAVLYGVDNETSATIKTESCYSSNADFAFCGNTFLESCQS IGDASGGGSFSSSELNGQPLNDSILDMESSSFSFLNQMPQSFIFPDLGDDFNQSAEITQFLTPE TNFSDSTGGDHTGPESYIALPSDVHGPERSGRCPLPPLEDRALHY*(-)  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | responsive to drought stress | 
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |