Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014719_circ_g.1 |
ID in PlantcircBase | zma_circ_008500 |
Alias | Zm05circ00049, zma_circ_0001865, GRMZM2G347721_C1 |
Organism | Zea mays |
Position | chr5: 60365747-60367904 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d014719 |
Parent gene annotation |
Putative pentatricopeptide repeat-containing protein |
Parent gene strand | - |
Alternative splicing | Zm00001d014717_circ_ag.1 Zm00001d014717_circ_ag.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014719_T010:4 Zm00001d014719_T017:4 Zm00001d014719_T001:4 Zm00001d014719_T002:4 Zm00001d014719_T011:4 Zm00001d014719_T012:4 Zm00001d014719_T023:4 Zm00001d014719_T009:4 Zm00001d014719_T006:4 Zm00001d014719_T021:4 Zm00001d014719_T019:4 Zm00001d014719_T003:4 Zm00001d014719_T013:4 Zm00001d014719_T004:4 Zm00001d014719_T020:4 Zm00001d014719_T015:4 Zm00001d014719_T018:4 Zm00001d014719_T005:4 Zm00001d014719_T022:4 Zm00001d014719_T014:4 Zm00001d014719_T008:4 Zm00001d014719_T007:4 Zm00001d014719_T016:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083236921 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
60366829-60365791(+) 60367876-60367806(-) |
Potential amino acid sequence |
MLKLSPNKFSNAGLYLRVVGEGIDHFFLVHVHLKAAQYKTLDLYGLPLSNRRNLFPG*(+) MYMDQKEVVDALSHHSKIEPCITELVWRQLEHQNPLFFKAYYMRLMLKNQIMVFNKLLQDQFEV INKEFSSGIPSMSLPNGSNSNLLKQNPCFLPETAPGSAMPDGIMHNGSSRGIINGTPSGDQLLN ASKDLHGLHNGIDASTSLQSDQNAAAVLYGVDNETSATIKTESCYSSNADFAFCGNTFLESCQS IGDASGGGSFSSSELNGQPLNDSILDMESSSFSFLNQMPQSFIFPDLGDDFNQSAEITQFLTPE TNFSDSTGGDHTGPESYIALPSDVHGPERSGRCPLPPLEDRALHY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |