Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0755100_circ_g.2 |
| ID in PlantcircBase | osa_circ_021954 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 31151329-31152377 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0755100 |
| Parent gene annotation |
Half-size ABC transporter, Internal detoxification of aluminum ( Os03t0755100-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0755100_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0755100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.192782555 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31151669-31151370(+) 31151356-31152316(-) |
| Potential amino acid sequence |
MFATSWKLTLLALVIVPVISIAVRKFGRFLRELSHQTQAAAAVASSIAEESFGAIRTVRSFAQE SHEVLRYGEKVDETLKLGLKQAFSLHSASGMAIQFC*(+) MPEALCKLKACLRPSFSVSSTFSPYRKTS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |