Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0568100_circ_g.2 |
| ID in PlantcircBase | osa_circ_034352 |
| Alias | Os_ciR3144 |
| Organism | Oryza sativa |
| Position | chr7: 22829566-22829831 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0568100 |
| Parent gene annotation |
LRR protein kinase, Common symbiosis signaling (SYM) pathway (Os 07t0568100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0568100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25991084 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22829660-22829591(+) 22829667-22829591(+) 22829658-22829690(-) |
| Potential amino acid sequence |
MSNGSLQDRLYGEASKRKVLDWPTRLSVCIGAARVEAAFCCAA*(+) MVLYRIASTVRRQKGKFLIGLPDYLFALVLLELRLLSAVRHDNLVPLIGYCCEKDQEILVYPFM SNGSLQDRLYGEASKRKVLDWPTRLSVCIGAARVEAAFCCAA*(+) MDRPKFLDPFHSNIQLVGPNYHAAQQKAASTLAAPMQTDSLVGQSRTFLFDASP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |