Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0657200_circ_g.5 |
| ID in PlantcircBase | osa_circ_035082 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 27658126-27659246 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os07g0657200 |
| Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os07t0657200-0 1);WD40/YVTN repeat-like domain containing protein. (Os07t065720 0-02);Similar to Sec31p. (Os07t0657200-03);Similar to Sec31p. (O s07t0657200-04) |
| Parent gene strand | + |
| Alternative splicing | Os07g0657200_circ_g.6 |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0657200-01:4 Os07t0657200-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.159818406 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27658296-27658311(+) 27659215-27658311(+) 27658150-27658606(-) |
| Potential amino acid sequence |
MSWCPYDSSYLLTCSKDNRTICWDTVSGEIMSELPASSNGNFDIHWYRKIPGVVAASSFDVKIG IYNLEFSGLYAAGDSAIGAPGLGCEENHFTSKRICGTLKRCNCYVVVPL*(+) MQLVIVLLVPQVWDVRKTISPVREFVGHSKGVIAMSWCPYDSSYLLTCSKDNRTICWDTVSGEI MSELPASSNGNFDIHWYRKIPGVVAASSFDVKIGIYNLEFSGLYAAGDSAIGAPGLGCEENHFT SKRICGTLKRCNCYVVVPL*(+) MVFLTSQTWGTNSTITSCIKAREL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |