Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0218150_circ_g.4 |
| ID in PlantcircBase | osa_circ_030206 |
| Alias | Os_ciR10753 |
| Organism | Oryza sativa |
| Position | chr6: 6043657-6044408 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0218150 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0218150-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0218150-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141953103 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6043800-6044359(-) 6043661-6043804(-) |
| Potential amino acid sequence |
MHTRHCATLRRESSMIWSTQFTREGLLQDSWCS*(-) MVNTVHQRRTITRFLVFLKMLRRKKSRGLFIHLQKGTIQTQTGGILLQKGHFRK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |