Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G252600_circ_g.4 |
| ID in PlantcircBase | gma_circ_007698 |
| Alias | gma-circRNA2674 |
| Organism | Glycine max |
| Position | chr19: 49810666-49811474 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_19G252600 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRG97112:3 KRG97110:3 KRG97109:3 KRG97114:3 KRG97113:3 KRG97111:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.080004821 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49810687-49810767(+) |
| Potential amino acid sequence |
MQGSPISKETAASNKMLAVVTAGVAGTIVGPVVSSGMTTTLELRNPSSVHSKASAPQPCPVLPA ETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVESLNAENATLKSEINRLTESSEK MRVENATLRMEKGKLRCKAVQFPKRLQLLIRCWQLSLLVLQEQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |