Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0683866_circ_g.3 |
| ID in PlantcircBase | osa_circ_021006 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 27261542-27262175 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0683866 |
| Parent gene annotation |
Similar to UPL7 (ubiquitin-protein ligase 7); ubiquitin-protein ligase. (Os03t0683866-00) |
| Parent gene strand | - |
| Alternative splicing | Os03g0683866_circ_g.1 Os03g0683866_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0683866-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291527037 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27262170-27262163(-) |
| Potential amino acid sequence |
MFREFIELDKASRRVTGEVSGPGPGSIEIVIRRGHIVEDGYRQLNCLGSKLKSCIHVSFVSECG LPEAGLDYGGLSKEFLTDLSKAAFSPEYGLFSQASASDSSLIPSNSAKLLDNGIDMIEFLGRVV GKALYEGILLDYCFSPVFVQKLLGRYSFLDELSTLDSELYRSLMQLKSADV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |