Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G254900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001467 |
| Alias | Chr13:57169356|57175525 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 57169356-57175525 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G254900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.013G254900_circ_g.2 |
| Support reads | 30/13 |
| Tissues | leaf/ovule |
| Exon boundary | No-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G254900.9:12 Gorai.013G254900.5:12 Gorai.013G254900.13:9 Gorai.013G254900.6:12 Gorai.013G254900.3:12 Gorai.013G254900.10:12 Gorai.013G254900.4:12 Gorai.013G254900.1:12 Gorai.013G254900.12:12 Gorai.013G254900.11:12 Gorai.013G254900.8:12 Gorai.013G254900.7:10 Gorai.013G254900.2:12 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000435* |
| PMCS | 0.518655731 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57175434-57169383(+) |
| Potential amino acid sequence |
MSKQILHQLRQLELLPFALYHQKSDLSSSLLISKTREEDC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |