Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0270100_circ_g.5 |
| ID in PlantcircBase | osa_circ_023238 |
| Alias | Os04circ02076/Os_ciR3379 |
| Organism | Oryza sativa |
| Position | chr4: 11276584-11277783 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os04g0270100 |
| Parent gene annotation |
Similar to GTP-binding protein. (Os04t0270100-01);Similar to GTP -binding protein. (Os04t0270100-02);Similar to G1 to S phase tra nsition protein 1 homolog (GTP-binding protein GST1- HS). (Os04t 0270100-03) |
| Parent gene strand | + |
| Alternative splicing | Os04g0270100_circ_g.2 Os04g0270100_circ_g.3 Os04g0270100_circ_g.4 Os04g0270100_circ_g.6 Os04g0270100_circ_g.7 |
| Support reads | 2/3/3 |
| Tissues | panicle/root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0270100-03:3 Os04t0270100-01:3 Os04t0270100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127668208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11277777-11276638(+) 11277392-11276622(+) |
| Potential amino acid sequence |
MHRCWKINCRRANTFLEWSSR*(+) MAYIMDTNEEERLKGKTVEVGRAHFETETTRFTILDAPMLENQLPEGKYFS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |