Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0479100_circ_g.3 |
ID in PlantcircBase | osa_circ_033785 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 17400925-17401522 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0479100 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0479100-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os07t0479100-02) |
Parent gene strand | + |
Alternative splicing | Os07g0479100_circ_g.4 Os07g0479100_circ_g.5 Os07g0479100_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0479100-01:2 Os07t0479100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147852592 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17400961-17400933(+) 17401451-17401490(-) 17400935-17401079(-) |
Potential amino acid sequence |
MGMSTESGMLRGAGVGVVSGAVFSIEAVESCIEIWRSSESGKYSIIFVLDIISSLFSGRIVWEK VSPALQRAVQSQWAH*(+) MMSSTKIMLYFPDSLDLQISMHDSTASMEKTAPETTPTPAPRSMPLSVDIPMNAPMKTPTNEPT DSAPRAAVLG*(-) MSPLTLHRALQCWADLLPHNPSTEEARDDVKHEDNAVFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |