Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0479100_circ_g.3 |
| ID in PlantcircBase | osa_circ_033785 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 17400925-17401522 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0479100 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os07 t0479100-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os07t0479100-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0479100_circ_g.4 Os07g0479100_circ_g.5 Os07g0479100_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0479100-01:2 Os07t0479100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147852592 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17400961-17400933(+) 17401451-17401490(-) 17400935-17401079(-) |
| Potential amino acid sequence |
MGMSTESGMLRGAGVGVVSGAVFSIEAVESCIEIWRSSESGKYSIIFVLDIISSLFSGRIVWEK VSPALQRAVQSQWAH*(+) MMSSTKIMLYFPDSLDLQISMHDSTASMEKTAPETTPTPAPRSMPLSVDIPMNAPMKTPTNEPT DSAPRAAVLG*(-) MSPLTLHRALQCWADLLPHNPSTEEARDDVKHEDNAVFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |