Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G07350_circ_g.6 |
ID in PlantcircBase | ath_circ_001141 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 2259003-2259152 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G07350 |
Parent gene annotation |
Serine/arginine-rich splicing factor SR45a |
Parent gene strand | - |
Alternative splicing | AT1G07350_circ_g.7 AT1G07350_circ_g.8 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G07350.2:1 AT1G07350.6:1 AT1G07350.1:1 AT1G07350.3:1 AT1G07350.4:1 AT1G07350.5:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.33643647 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2259087-2259005(-) |
Potential amino acid sequence |
MKSVGDANRCIRSLDHSVLQGRVITVEKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSL DHSVLQGRVITVEKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEK VTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |