Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc12g056080.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003648 |
| Alias | 12:47413088|47413555 |
| Organism | Solanum lycopersicum |
| Position | chr12: 62055340-62055807 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc12g056080.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc12g056080.1.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.464495833 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62055654-62055348(+) 62055366-62055751(-) |
| Potential amino acid sequence |
MRSTWNGLQKIAMLGANSPSWRGPCMKRIEPGLFLSLQLTNLLWICRSYYGRECLKLIPHQKFS FAKIWLLAAQFEIRQLRLKEARLLLGEAIGRAPKDKIFKKYIEIELHFGNIDRCRKLYEKYLEW SPENCYAWSKFAELERSLYETDRARAIFELAIDQPALDMPELLWKGVS*(+) MWNQLKTLPSIIAPAYPEQVGQLQAQK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |