Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g056080.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003648 |
Alias | 12:47413088|47413555 |
Organism | Solanum lycopersicum |
Position | chr12: 62055340-62055807 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g056080.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 8 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc12g056080.1.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.464495833 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
62055654-62055348(+) 62055366-62055751(-) |
Potential amino acid sequence |
MRSTWNGLQKIAMLGANSPSWRGPCMKRIEPGLFLSLQLTNLLWICRSYYGRECLKLIPHQKFS FAKIWLLAAQFEIRQLRLKEARLLLGEAIGRAPKDKIFKKYIEIELHFGNIDRCRKLYEKYLEW SPENCYAWSKFAELERSLYETDRARAIFELAIDQPALDMPELLWKGVS*(+) MWNQLKTLPSIIAPAYPEQVGQLQAQK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |