Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G196400_circ_g.1 |
| ID in PlantcircBase | gma_circ_007466 |
| Alias | gma-circRNA2369 |
| Organism | Glycine max |
| Position | chr17: 30694622-30717008 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_17G196400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_17G196400_circ_g.2 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH04925:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.001147021 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30716937-30694623(+) 30717006-30716984(-) |
| Potential amino acid sequence |
MLITAYKVASTKSTYFKNKCAFHTT*(+) MEGTLIFKVSRFGAGYFIGCDQHPRCKYIAKTLYGTEEEEDASQPNSRVEEPKLLGVTSGSYEK VLLKSGPYGVYVQLGEDRKGYIPKRASVSHIKDVDSITLKDALEVLQYPLTLGNHPKDGQPVIL KLARAGLCVRHRRTVASVPKLYGRHTYF*(-) |
| Sponge-miRNAs | gma-miR9726 gma-miR1533 gma-miR1511 gma-miR156aa |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |