Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g056060.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001837 |
| Alias | 5:64607539|64607827, Slcirc081 |
| Organism | Solanum lycopersicum |
| Position | chr5: 65461189-65461477 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc05g056070.2 |
| Parent gene annotation |
Chlorophyll a-b binding protein, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/32 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc05g056060.2.1:1 Solyc05g056060.2.1:1 Solyc05g056070.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.314298847 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
65461367-65461223(+) 65461476-65461223(+) 65461342-65461380(-) |
| Potential amino acid sequence |
MEKDSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNARNHSTRGIGLR*(+) MPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKD SEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNARNHSTRGIGLR*(+) MARNSIAKIVGSVPHGTGWPKYVACPPGMAAHSWALTQLPKPNASGTMIPGILDFLDFEFFKFS RVFRVAQWVKSPTRVLLLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018; Wang et al., 2018b |