Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G242300_circ_g.4 |
| ID in PlantcircBase | gra_circ_001260 |
| Alias | Chr11:56923275|56923656 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 56923275-56923656 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G242300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.011G242300_circ_g.1 orai.011G242300_circ_g.2 orai.011G242300_circ_g.3 |
| Support reads | 81 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.011G242300.2:1 Gorai.011G242300.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs |
ghi_circ_000378* gar_circ_000846 ghi_circ_000162* ghi_circ_000377* gar_circ_000848 ghi_circ_000161* |
| PMCS | 0.760295506 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
56923300-56923606(-) 56923620-56923632(-) |
| Potential amino acid sequence |
MACEGYYTAIMVQSLQLRMVECQQM*(-) MSADVINKAFLATEEDFLALVRKQWLNDPHMASVGSCCLVGIVCSGMLYIANAGDSRVVLGRLD KTYKEVKAVPLSSEHNASVESVREELRSLHPTDPQIVVLKHTVWRVKGIIQLLWCRVYN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |