Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0292900_circ_g.3 |
ID in PlantcircBase | osa_circ_036608 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 11763192-11763597 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0292900 |
Parent gene annotation |
Similar to Isoform 2 of Homeobox protein knotted-1-like 13. (Os0 8t0292900-01) |
Parent gene strand | + |
Alternative splicing | Os08g0292900_circ_g.1 Os08g0292900_circ_g.2 Os08g0292900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0292900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007645* |
PMCS | 0.265398604 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11763225-11763335(+) 11763227-11763550(-) |
Potential amino acid sequence |
MSDGEDDQADSEANMYDPSLDGADNMGFGLPTESERSLMERVRQELKHELKQGYKEKLIDIREE ILRKRRAGKLPGDTTSTLKAWWQSHAKWPYPTVPRPVKAREQPCQTVKMIRQIARQTCMIQAWM ERITWVSAFPQKASDP*(+) MVAPVPSPGEALLDMATLHETATKLLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |