Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0292900_circ_g.3 |
| ID in PlantcircBase | osa_circ_036608 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 11763192-11763597 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0292900 |
| Parent gene annotation |
Similar to Isoform 2 of Homeobox protein knotted-1-like 13. (Os0 8t0292900-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0292900_circ_g.1 Os08g0292900_circ_g.2 Os08g0292900_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0292900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007645* |
| PMCS | 0.265398604 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11763225-11763335(+) 11763227-11763550(-) |
| Potential amino acid sequence |
MSDGEDDQADSEANMYDPSLDGADNMGFGLPTESERSLMERVRQELKHELKQGYKEKLIDIREE ILRKRRAGKLPGDTTSTLKAWWQSHAKWPYPTVPRPVKAREQPCQTVKMIRQIARQTCMIQAWM ERITWVSAFPQKASDP*(+) MVAPVPSPGEALLDMATLHETATKLLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |