Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0370000_circ_g.2 |
| ID in PlantcircBase | osa_circ_006626 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 11632138-11632876 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0370000 |
| Parent gene annotation |
Protein phosphatase 2C-related domain containing protein. (Os10t 0370000-01);Protein phosphatase 2C-related domain containing pro tein. (Os10t0370000-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0370000_circ_g.3 Os10g0370000_circ_g.4 Os10g0370000_circ_g.5 Os10g0370000_circ_g.6 Os10g0370000_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0370000-01:3 Os10t0370000-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_001948 |
| PMCS | 0.12528189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11632501-11632477(+) 11632538-11632865(-) 11632208-11632865(-) |
| Potential amino acid sequence |
MPTQALMRLLEPSYQYSSPLKCPFPNLPCYKLLPSNDHWPTPSATPNQPSHAIKYASSPPVAAL EG*(+) MVPVASSTLVLASGAAILPHPSKAATGGEDAYFIACDGWFGVADGVGQWSFEGRSL*(-) MHILLRVMAGLVWLMELASGHLKEEVCNKVDWEKDTSEVKNTDRMVPVASSTLVLASGAAILPH PSKAATGGEDAYFIACDGWFGVADGVGQWSFEGRSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |