Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0370000_circ_g.2 |
ID in PlantcircBase | osa_circ_006626 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 11632138-11632876 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0370000 |
Parent gene annotation |
Protein phosphatase 2C-related domain containing protein. (Os10t 0370000-01);Protein phosphatase 2C-related domain containing pro tein. (Os10t0370000-02) |
Parent gene strand | - |
Alternative splicing | Os10g0370000_circ_g.3 Os10g0370000_circ_g.4 Os10g0370000_circ_g.5 Os10g0370000_circ_g.6 Os10g0370000_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0370000-01:3 Os10t0370000-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_001948 |
PMCS | 0.12528189 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11632501-11632477(+) 11632538-11632865(-) 11632208-11632865(-) |
Potential amino acid sequence |
MPTQALMRLLEPSYQYSSPLKCPFPNLPCYKLLPSNDHWPTPSATPNQPSHAIKYASSPPVAAL EG*(+) MVPVASSTLVLASGAAILPHPSKAATGGEDAYFIACDGWFGVADGVGQWSFEGRSL*(-) MHILLRVMAGLVWLMELASGHLKEEVCNKVDWEKDTSEVKNTDRMVPVASSTLVLASGAAILPH PSKAATGGEDAYFIACDGWFGVADGVGQWSFEGRSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |