Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0140200_circ_g.4 |
| ID in PlantcircBase | osa_circ_006173 |
| Alias | Os_ciR6932 |
| Organism | Oryza sativa |
| Position | chr10: 2482015-2483563 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os10g0140200 |
| Parent gene annotation |
Glycoside hydrolase, family 38 domain containing protein. (Os10t 0140200-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0140200_circ_g.5 |
| Support reads | 2/8 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0140200-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008759 |
| PMCS | 0.126569712 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2482089-2482088(+) |
| Potential amino acid sequence |
MISGYYLAARQLEFLVGRSSLGLFTSSLEDPLGIAQHHDAVSGTAKQHTTDDYSKRLAIGVSQV EKGVNTALSCLTSSKGTCTATKFSQCQLLNISYCPSTEEGISSAKSLVIVVYNPLGWERSDFVR VPVNDANLIVKTSDGTSLESQLVEVDIVTARLRKLYIKAYLGITSDKPPKYWLVFQASVPPLGW NTYFISKSTGTGMLMQKMLTGLDILQAVQLSSDIFE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |