Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0140200_circ_g.4 |
ID in PlantcircBase | osa_circ_006173 |
Alias | Os_ciR6932 |
Organism | Oryza sativa |
Position | chr10: 2482015-2483563 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os10g0140200 |
Parent gene annotation |
Glycoside hydrolase, family 38 domain containing protein. (Os10t 0140200-01) |
Parent gene strand | + |
Alternative splicing | Os10g0140200_circ_g.5 |
Support reads | 2/8 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0140200-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008759 |
PMCS | 0.126569712 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2482089-2482088(+) |
Potential amino acid sequence |
MISGYYLAARQLEFLVGRSSLGLFTSSLEDPLGIAQHHDAVSGTAKQHTTDDYSKRLAIGVSQV EKGVNTALSCLTSSKGTCTATKFSQCQLLNISYCPSTEEGISSAKSLVIVVYNPLGWERSDFVR VPVNDANLIVKTSDGTSLESQLVEVDIVTARLRKLYIKAYLGITSDKPPKYWLVFQASVPPLGW NTYFISKSTGTGMLMQKMLTGLDILQAVQLSSDIFE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |