Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G54310_circ_g.2 |
ID in PlantcircBase | ath_circ_007307 |
Alias | AT1G54310_C1, AT1G54310_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 20273780-20274005 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G54310 |
Parent gene annotation |
S-adenosyl-L-methionine-dependent methyltransferases superfamily protein |
Parent gene strand | + |
Alternative splicing | AT1G54310_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G54310.2:1 AT1G54310.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.625981377 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20273916-20273786(+) 20273840-20273786(+) |
Potential amino acid sequence |
MALRIPLVGVCITLFLCSVFALCSFNTNPPGVAKVVLKKGKTQLFKDGSPMVYSGAVDRIIGKP PPQTGDVVIVADGTENPIGWGLYNSVSMFCVRLMQLQHESTRCC* MVYSGAVDRIIGKPPPQTGDVVIVADGTENPIGWGLYNSVSMFCVRLMQLQHESTRCC* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |