Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0238000_circ_g.2 |
| ID in PlantcircBase | osa_circ_010934 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 7617994-7619139 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os12g0238000 |
| Parent gene annotation |
SANT domain, DNA binding domain containing protein. (Os12t023800 0-00) |
| Parent gene strand | - |
| Alternative splicing | Os12g0238000_circ_g.1 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0238000-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134685878 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7619133-7619113(+) |
| Potential amino acid sequence |
MESSLDHGPLTNSGFRTFCHLCKHCTSVLSGKHSAIFFQFFPLYV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |