Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0238000_circ_g.2 |
ID in PlantcircBase | osa_circ_010934 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 7617994-7619139 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os12g0238000 |
Parent gene annotation |
SANT domain, DNA binding domain containing protein. (Os12t023800 0-00) |
Parent gene strand | - |
Alternative splicing | Os12g0238000_circ_g.1 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0238000-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134685878 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7619133-7619113(+) |
Potential amino acid sequence |
MESSLDHGPLTNSGFRTFCHLCKHCTSVLSGKHSAIFFQFFPLYV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |