Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0137100_circ_g.2 |
| ID in PlantcircBase | osa_circ_013047 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 1969379-1969970 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os02g0137100 |
| Parent gene annotation |
Similar to plant-specific domain TIGR01589 family protein. (Os02 t0137100-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0137100_circ_g.1 Os02g0137100_circ_g.3 Os02g0137100_circ_g.4 Os02g0137100_circ_g.5 Os02g0137100_circ_g.6 Os02g0137100_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0137100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160319243 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1969416-1969392(+) 1969951-1969392(+) |
| Potential amino acid sequence |
MNQKEVVETLSFQAKIEPSFTELVWQKLEEENREFFKAYYVRLMLKNQIMVFNKLLEDQYRLMC KEQPSGVPSMPPTTNGSNMGTCPESY*(+) MAPTWAHVQNLIERCLQLYMNQKEVVETLSFQAKIEPSFTELVWQKLEEENREFFKAYYVRLML KNQIMVFNKLLEDQYRLMCKEQPSGVPSMPPTTNGSNMGTCPESY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |