Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0175700_circ_g.2 |
| ID in PlantcircBase | osa_circ_000498 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 3895929-3897068 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0175700 |
| Parent gene annotation |
Boron (B) transporter (Os01t0175700-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0175633_circ_ag.1 Os01g0175633_circ_ag.2 Os01g0175633_circ_ag.3 Os01g0175633_circ_ag.4 Os01g0175633_circ_ag.5 Os01g0175633_circ_ag.6 Os01g0175633_circ_ag.7 Os01g0175700_circ_g.1 Os01g0175733_circ_igg.1 |
| Support reads | 10 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0175733-00:4 Os01t0175700-01:4 Os01t0175733-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.164555694 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3895977-3897046(-) 3897029-3897023(-) |
| Potential amino acid sequence |
MARFKGFSSRWTAKKMVAQRLHC*(-) MVIVWTAFSYTLPKDVPSGVPRRLFSPLPWESSSLQHWTVAKDLFSVPPAYIFAAILPALMVAG LYFFDHSVASQLAQQKEFNLKKPSAYHYDILVLGFMVLLCGLIGIPPSNGVLPQSPMHTRSLAV LKGQLLRKKMVQTANEGLMNRASSLEIYGKIQGVFIEMDCEKNGGSEASLLIMVSHLW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |