Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0623600_circ_g.1 |
| ID in PlantcircBase | osa_circ_031429 |
| Alias | Os_ciR1823 |
| Organism | Oryza sativa |
| Position | chr6: 25087589-25088282 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0623600 |
| Parent gene annotation |
Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44). (Os06t0623600- 01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0623600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006847* osi_circ_016440 |
| PMCS | 0.347016318 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25088193-25087623(+) 25087649-25088206(-) |
| Potential amino acid sequence |
MGRVSQDPIHFSSHNQRPQSPQVFSQGYTNFVGKFVTGIPAL*(+) MPHIIDLLKSWYPGYKFADKIGIPLGKHLRRLRPLIMRREVDWIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |