Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G52410_circ_g.3 |
ID in PlantcircBase | ath_circ_006997 |
Alias | AT1G52410_C3, AT1G52410_C3 |
Organism | Arabidpsis thaliana |
Position | chr1: 19520929-19521714 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G52410 |
Parent gene annotation |
TSK-associating protein 1 |
Parent gene strand | + |
Alternative splicing | AT1G52410_circ_g.1 AT1G52410_circ_g.2 AT1G52410_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G52410.2:5 AT1G52410.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130318162 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19521280-19520928(+) |
Potential amino acid sequence |
MNLRLDLLVMKALDVRVCWIKSNLNSKLITIVLTKLDLMVSRLNPRMMMKNYDDGSGLSNLDLI ERDYQDSVNALQGKDDEDQSAKIQSENQNNTTVTDKNTISLSLSDESEVGSVSDESVGRSSLLD QIKLEFEAHHNSINQAGSDGVKAESKDDDEEL* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |