Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0312500_circ_g.1 |
ID in PlantcircBase | osa_circ_014432 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 12321193-12321806 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0312500 |
Parent gene annotation |
Similar to predicted protein. (Os02t0312500-01);Optic atrophy 3 family protein. (Os02t0312500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0312500-02:2 Os02t0312500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.148500163 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12321242-12321243(-) |
Potential amino acid sequence |
MAIYSSLDICGDPMICLNFVSTSLLFSGLGPCASLHLKDYSSPSNRENKELPNKISSSLNSFLL VQRPNLNLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |