Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0534200_circ_g.1 |
| ID in PlantcircBase | osa_circ_040008 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20990397-20991468 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0534200 |
| Parent gene annotation |
Similar to ER lumen protein retaining receptor C28H8.4. (Os09t05 34200-00) |
| Parent gene strand | + |
| Alternative splicing | Os09g0534200_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0534200-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.154937267 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20991414-20990442(+) 20990466-20990420(+) |
| Potential amino acid sequence |
MCLHWELQGFLAVHTGFFRTIPQVSGFNCVVSSC*(+) MEYDIHTVLDTATLAATLFVIYMIRFKLRPTYMVDKDNFALYYVVVPCAVLALLIHPSTSHNIV NRISWAFCVYLEAVSVLPQLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQDYPSSLRI*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |