Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0534200_circ_g.1 |
ID in PlantcircBase | osa_circ_040008 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20990397-20991468 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0534200 |
Parent gene annotation |
Similar to ER lumen protein retaining receptor C28H8.4. (Os09t05 34200-00) |
Parent gene strand | + |
Alternative splicing | Os09g0534200_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0534200-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.154937267 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20991414-20990442(+) 20990466-20990420(+) |
Potential amino acid sequence |
MCLHWELQGFLAVHTGFFRTIPQVSGFNCVVSSC*(+) MEYDIHTVLDTATLAATLFVIYMIRFKLRPTYMVDKDNFALYYVVVPCAVLALLIHPSTSHNIV NRISWAFCVYLEAVSVLPQLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQDYPSSLRI*( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |