Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G07020_circ_g.1 |
| ID in PlantcircBase | ath_circ_020204 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2218891-2219160 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G07020 |
| Parent gene annotation |
Sterol 3-beta-glucosyltransferase UGT80A2 |
| Parent gene strand | - |
| Alternative splicing | AT3G07020_circ_g.2 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G07020.3:2 AT3G07020.2:2 AT3G07020.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.316268365 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2219140-2218893(-) |
| Potential amino acid sequence |
MTEIIVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEI IVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEIIVEA LQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEIIVEALQRT KQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |