Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G07020_circ_g.1 |
ID in PlantcircBase | ath_circ_020204 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 2218891-2219160 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G07020 |
Parent gene annotation |
Sterol 3-beta-glucosyltransferase UGT80A2 |
Parent gene strand | - |
Alternative splicing | AT3G07020_circ_g.2 |
Support reads | 1 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G07020.3:2 AT3G07020.2:2 AT3G07020.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.316268365 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2219140-2218893(-) |
Potential amino acid sequence |
MTEIIVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEI IVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEIIVEA LQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVPVQEPEKMTEIIVEALQRT KQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAV(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |