Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G19870_circ_g.1 |
ID in PlantcircBase | ath_circ_003461 |
Alias | Ath_circ_FC0439 |
Organism | Arabidpsis thaliana |
Position | chr1: 6897065-6897385 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G19870 |
Parent gene annotation |
Protein IQ-DOMAIN 32 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G19870.1:2 AT1G19870.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.306898347 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6897305-6897067(-) |
Potential amino acid sequence |
MGSLRCVQAIVKMQAMVRARHSTKDGSRVSATSDKSEPNAAAQKLLENKFAKHARRELLRSKKV IKLQAAVRGHLVRSQAMGSLRCVQAIVKMQAMVRARHSTKDGSRVSATSDKSEPNAAAQKLLEN KFAKHARRELLRSKKVIKLQAAVRGHLVRSQAMGSLRCVQAIVKMQAMVRARHSTKDGSRVSAT SDKSEPNAAAQKLLENKFAKHARRELLRSKKVIKLQAAVRGHLVRSQAMGSLRCVQAIVKMQAM VRARHSTKDGSRVSATSDKSEPNAAAQKLLENKFAKH(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |