Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0525200_circ_g.3 |
| ID in PlantcircBase | osa_circ_039900 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20521054-20522005 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0525200 |
| Parent gene annotation |
Protein of unknown function DUF947 family protein. (Os09t0525200 -01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0525200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.24907261 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20522005-20521256(+) 20521257-20521256(+) 20521271-20521951(-) |
| Potential amino acid sequence |
MFRKRYNFLFDDELPAEKEKLQKSIKKSKDPNAIEEMKSRITWIDKQLRSHPKKNVESEILREH IKKEREATKTGKRPYYLKKCSGKDTISYLMMNFLQRKRNYKNRLRNQRTLMPLKK*(+) MKSRITWIDKQLRSHPKKNVESEILREHIKKEREATKTGKRPYYLKKCSGKDTISYLMMNFLQR KRNYKNRLRNQRTLMPLKK*(+) MRLFISSMALGSFDFLIDFCSFSFSAGSSSSNKKLYLFLNISSDNMVAFQSLLLPSLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |