Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G24870_circ_g.1 |
| ID in PlantcircBase | ath_circ_023675 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 9078471-9078587 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G24870 |
| Parent gene annotation |
Chromatin modification-related protein EAF1 B |
| Parent gene strand | - |
| Alternative splicing | 3_circ_ag.6 3_circ_ag.7 3_circ_ag.8 3_circ_ag.9 3_circ_ag.2 3_circ_ag.3 AT3G24870_circ_g.4 3_circ_ag.5 3_circ_ag.6 3_circ_ag.7 AT3G24870_circ_g.8 3_circ_ag.9 3_circ_ag.10 3_circ_ag.11 3_circ_ag.12 3_circ_ag.13 3_circ_ag.14 3_circ_ag.15 AT3G24870_circ_g.16 3_circ_ag.17 3_circ_ag.18 3_circ_ag.19 3_circ_ag.20 3_circ_ag.21 3_circ_ag.22 3_circ_ag.23 AT3G24880_circ_g.1 AT3G24880_circ_g.2 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G24870.1:1 AT3G24870.3:1 AT3G24870.4:1 AT3G24870.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.389617094 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9078549-9078473(-) |
| Potential amino acid sequence |
MEEDTLKSHFEKICLIGKKLHYRKTQGSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYRKT QGSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYRKTQGSARQLFQRLQGPMEEDTLKSHFE KICLIGKKLHYRKTQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |