Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G24870_circ_g.1 |
ID in PlantcircBase | ath_circ_023675 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 9078471-9078587 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G24870 |
Parent gene annotation |
Chromatin modification-related protein EAF1 B |
Parent gene strand | - |
Alternative splicing | 3_circ_ag.6 3_circ_ag.7 3_circ_ag.8 3_circ_ag.9 3_circ_ag.2 3_circ_ag.3 AT3G24870_circ_g.4 3_circ_ag.5 3_circ_ag.6 3_circ_ag.7 AT3G24870_circ_g.8 3_circ_ag.9 3_circ_ag.10 3_circ_ag.11 3_circ_ag.12 3_circ_ag.13 3_circ_ag.14 3_circ_ag.15 AT3G24870_circ_g.16 3_circ_ag.17 3_circ_ag.18 3_circ_ag.19 3_circ_ag.20 3_circ_ag.21 3_circ_ag.22 3_circ_ag.23 AT3G24880_circ_g.1 AT3G24880_circ_g.2 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G24870.1:1 AT3G24870.3:1 AT3G24870.4:1 AT3G24870.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.389617094 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9078549-9078473(-) |
Potential amino acid sequence |
MEEDTLKSHFEKICLIGKKLHYRKTQGSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYRKT QGSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYRKTQGSARQLFQRLQGPMEEDTLKSHFE KICLIGKKLHYRKTQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |