Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G40850_circ_g.5 |
ID in PlantcircBase | ath_circ_041785 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 16368007-16368076 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G40850 |
Parent gene annotation |
AT5g40850/MHK7_8 |
Parent gene strand | + |
Alternative splicing | AT5G40850_circ_g.3 AT5G40850_circ_g.4 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G40850.2:1 AT5G40850.3:1 AT5G40850.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182142977 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16368031-16368073(+) |
Potential amino acid sequence |
MDFLQQQGIRVQVIPGLWTGRRRNGLSATARDSSSSYTRSLDGAAKKWTFCNSKGFEFKLYQVF GRGGEEMDFLQQQGIRVQVIP(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |