Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0672500_circ_g.18 |
ID in PlantcircBase | osa_circ_035257 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 28433646-28433830 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0672500 |
Parent gene annotation |
Hypothetical conserved gene. (Os07t0672500-01);ATPase, AAA-type, core domain containing protein. (Os07t0672500-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0672500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017472 |
PMCS | 0.976217297 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28433656-28433703(+) 28433689-28433814(-) |
Potential amino acid sequence |
MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMACW VEGRTQGNMKLCAR*(+) MFPWVLPSTQHAINLLGSLLTTASSRSNGLLVAASTNTRSLSFVLRPSQFTINSFFILRIASCS PGFSLLPSMPSTSWGAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |