Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0683700_circ_g.1 |
| ID in PlantcircBase | osa_circ_020998 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 27239242-27239740 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0683700 |
| Parent gene annotation |
Conserved hypothetical protein. (Os03t0683700-01);Hypothetical c onserved gene. (Os03t0683700-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0683700_circ_g.2 Os03g0683700_circ_g.3 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0683700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.302163995 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27239325-27239256(+) 27239698-27239290(+) 27239718-27239589(-) |
| Potential amino acid sequence |
MDEENVVELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGEA LDLGDAIRLFHDSLDYPYVESDAG*(+) MPSGFFMTALTTLTWRAMLAESDLGCFQQCF*(+) MKKPDGISKVKCFTFLSTIEDVINTDLIYIHIIQRDRTRRHYNFLDQVTRKHVVEQYMTVTAIT LQQLNNIFFVHIVCRGDSNLSSETLLEAPQVAFSQHRSPRKGSQGCHEKAGWHLQGQVLHLS*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |