Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0856200_circ_g.1 |
| ID in PlantcircBase | osa_circ_022788 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 36117539-36119154 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0856200 |
| Parent gene annotation |
Similar to KAP-2. (Os03t0856200-01);Similar to Longin-like. (Os0 3t0856200-02);Similar to KAP-2. (Os03t0856200-03);Similar to KAP -2. (Os03t0856200-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0856200-04:3 Os03t0856200-03:4 Os03t0856200-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155587613 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36118728-36118320(+) |
| Potential amino acid sequence |
MLTQRSSSTWVQTAIEEMQKYITALIQDSCDRDNHQKALECLVALRKACIIEQEPNEYNGFVTK LCQKFRPAGDKIFLQLLSSKKASLISKEEAPDRHYFMKDVFSFVPEPGNTKAVAAVSALARAMS EMNKVAILRCVWRQGQGNVALGVLTPNISSAKNVLDSFYFNILPFAEDIREFQFRSFSSLPSSS QPTKEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLEVP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |