Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0231700_circ_g.2 |
ID in PlantcircBase | osa_circ_027108 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 8001138-8001391 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0231600 |
Parent gene annotation |
Similar to Aquaglyceroporin (Tonoplast intrinsic protein (Tipa)) . (Os05t0231600-01) |
Parent gene strand | - |
Alternative splicing | Os05g0231700_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0231700-01:1 Os05t0231600-01:1 Os05t0231700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_009665 |
PMCS | 0.304180676 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8001165-8001224(+) 8001302-8001380(-) |
Potential amino acid sequence |
MPMAALAGVAIATALAAGVLVTAGFHVSGGHLNPAVTVALLARGHITAFRSALYVAAQLLASSL ACILLRYLTGGMGCRRWRGRRCRWRRWRGWRSRRRWRRGCW*(+) MCPRASSATVTAGFRCPPDTWNPAVTSTPAASAVAIATPASAAIGIAAPATSGTPCRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |