Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G48120_circ_g.1 |
| ID in PlantcircBase | ath_circ_006263 |
| Alias | At_ciR2414 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17775444-17775858 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G48120 |
| Parent gene annotation |
Serine/threonine-protein phosphatase 7 long form homolog |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G48120.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.151311606 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17775799-17775446(-) |
| Potential amino acid sequence |
MNGGYAEDHEGLITLFSAPDHPQFQDTEERHNNKAAYIILQIPECEELKFQPLEAVSPRPKWII RGKGAPDERAKRDDLAPMNGGYAEDHEGLITLFSAPDHPQFQDTEERHNNKAAYIILQIPECEE LKFQPLEAVSPRPKWIIRGKGAPDERAKRDDLAPMNGGYAEDHEGLITLFSAPDHPQFQDTEER HNNKAAYIILQIPECEELKFQPLEAVSPRPKWIIRGKGAPDERAKRDDLAPMNGGYAEDHEGLI TLFSAPDHPQFQDTEERHNNKAAYIILQIPECEELKFQPLEAVSPRPK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |