Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18041332_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000305 |
| Alias | circRNA307 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006262201.1: 26967856-26970217 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18041332 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | XM_024183270.1:3 XM_024183272.1:3 XM_006432669.2:3 XM_024183273.1:3 XM_024183271.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26970190-26970118(-) 26970161-26967864(+) |
| Potential amino acid sequence |
MSLSYQSKPIILLVASMDSASFFRDKSLGADSPISGLLSLLAAVDALSRVDGWNDLNKQLVFLV LTGEAWGYLGSRRFLHELDMQSDGVSGLNSSLIEMCLVFSSTNQYVIVIPVQAHYIVGGIYGFC IFLP*(-) MGLDWYDNDILIGGREDQTHLN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |