Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G005800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000804 |
| Alias | Chr08:746326|747474 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 746326-747474 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G005800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.008G005800.3:2 Gorai.008G005800.1:3 Gorai.008G005800.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.0984915 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
746882-746353(+) |
| Potential amino acid sequence |
MSGSNELENGELDLSLLSDLMGLQPLMFGVHQQPYASSLIYPSSKIDYQVPLPDFLGEMIHYSK ITVNPDGQVVLTATGTEMKDILSIVAEFYLSSNSTKSRNQFSLVPYFDRKRITKARTGTNLSSP QSEVASIAPMKRSLVPSSQVS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |