Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G19110_circ_g.1 |
| ID in PlantcircBase | ath_circ_003387 |
| Alias | At_ciR3955 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 6602832-6602984 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT1G19110 |
| Parent gene annotation |
Inter-alpha-trypsin inhibitor heavy chain-like protein |
| Parent gene strand | + |
| Alternative splicing | AT1G19110_circ_g.2 AT1G19110_circ_g.3 AT1G19110_circ_g.4 AT1G19110_circ_g.5 |
| Support reads | 16 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G19110.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.419595308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6602963-6602834(-) |
| Potential amino acid sequence |
MLGFKKPPVSGSAVFSNSFPSSAVINCVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSA VFSNSFPSSAVINCVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSAVFSNSFPSSAVIN CVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSAVFSNSFPSSAVINCVVYDFLGISTST PSID(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |