Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G19110_circ_g.1 |
ID in PlantcircBase | ath_circ_003387 |
Alias | At_ciR3955 |
Organism | Arabidpsis thaliana |
Position | chr1: 6602832-6602984 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G19110 |
Parent gene annotation |
Inter-alpha-trypsin inhibitor heavy chain-like protein |
Parent gene strand | + |
Alternative splicing | AT1G19110_circ_g.2 AT1G19110_circ_g.3 AT1G19110_circ_g.4 AT1G19110_circ_g.5 |
Support reads | 16 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G19110.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.419595308 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6602963-6602834(-) |
Potential amino acid sequence |
MLGFKKPPVSGSAVFSNSFPSSAVINCVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSA VFSNSFPSSAVINCVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSAVFSNSFPSSAVIN CVVYDFLGISTSTPSIDPCGIVRVKMLGFKKPPVSGSAVFSNSFPSSAVINCVVYDFLGISTST PSID(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |